TC38, a teleost TFPI-2 peptide that kills bacteria via penetration of the cell membrane and interaction with nucleic acids

TC38, a teleost TFPI-2 peptide that kills bacteria via penetration of the cell membrane and interaction with nucleic acids

M Zhang, B Yue, A Zhang, G Wang, Y Liu… - Fish & Shellfish …, 2017 - Elsevier

... RNCMEVCVKGEKKHTGQGMIRRLRRNKNNSIFVVRKRV), derived from the C-terminal of the
tongue sole TFPI-2 protein [30], as well as a control peptide P86P15, derived from a capsid protein
of fish Megalocytivirus [35], were chemically synthesized by Pepmic (Suzhou, China ...

For Peptide Synthesis inquiry and ordering, please contact:

Eva He

eva@pepmic.com

Pepmic Co., Ltd

www.pepmic.com