| Peptide Name | Musclin / Osteocrin (Ostn) (39-75) (Mouse) - Biotin Labeled |
| Sequence | Ser-Leu-Gln-Ser-Pro-Pro-Thr-Ala-Arg-Glu-Glu-Lys-Ser-Ala-Thr-Glu-Leu-Ser-Ala-Lys-Leu-Leu-Arg-Leu-Asp-Asp-Leu-Val-Ser-Leu-Glu-Asn-Asp-Val-Phe-Glu-Thr |
| Species | Mouse |
| M.W | |
| Solubility | |
| Storage Condition | |
| Appearance | |
| Contact Information | peptide@pepmic.com |
| Website | www.pepmic.com |
Peptide synthesis/Peptide Library Synthesis/Peptide Modification/Antibody Preparation Eve He eve@pepmic.com www.pepmic.com
2019年6月30日星期日
Musclin / Osteocrin (Ostn) (39-75) (Mouse) - Biotin Labeled
Musclin / Osteocrin (Ostn) (31-78) (Human) - Biotin Labeled
| Peptide Name | Musclin / Osteocrin (Ostn) (31-78) (Human) - Biotin Labeled |
| Sequence | Thr-Thr-Thr-Glu-Ala-Phe-Asp-Ser-Gly-Val-Leu-Asp-Val-Gln-Ser-Thr-Pro-Thr-Val-Arg-Glu-Glu-Lys-Ser-Ala-Thr-Asp-Leu-Thr-Ala-Lys-Leu-Leu-Leu-Leu-Asp-Glu-Leu-Val-Ser-Leu-Glu-Asn-Asp-Val-Ile-Glu-Thr |
| Species | Human |
| M.W | |
| Solubility | |
| Storage Condition | |
| Appearance | |
| Contact Information | peptide@pepmic.com |
| Website | www.pepmic.com |
Musclin / Osteocrin (Ostn) (116-133) (Human) - Biotin Labeled
| Peptide Name | Musclin / Osteocrin (Ostn) (116-133) (Human) - Biotin Labeled |
| Sequence | Phe-Gly-Ile-Pro-Met-Asp-Arg-Ile-Gly-Arg-Asn-Arg-Leu-Ser-Asn-Ser-Arg-Gly |
| Species | Human |
| M.W | |
| Solubility | |
| Storage Condition | |
| Appearance | |
| Contact Information | peptide@pepmic.com |
| Website | www.pepmic.com |
Musclin / Osteocrin (Ostn) (113-130) (Mouse) / (115-132) (Rat) - Biotin Labeled
| Peptide Name | Musclin / Osteocrin (Ostn) (113-130) (Mouse) / (115-132) (Rat) - Biotin Labeled |
| Sequence | Phe-Gly-Ile-Pro-Met-Asp-Arg-Ile-Gly-Arg-Asn-Arg-Leu-Ser-Ser-Ser-Arg-Gly |
| Species | Rat, Mouse |
| M.W | |
| Solubility | |
| Storage Condition | |
| Appearance | |
| Contact Information | peptide@pepmic.com |
| Website | www.pepmic.com |
MSH, Gamma2 (Human, Rat, Mouse) - Biotin Labeled
| Peptide Name | MSH, Gamma2 (Human, Rat, Mouse) - Biotin Labeled |
| Sequence | Biotinyl-Tyr-Val-Met-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly |
| Species | |
| M.W | 1797.08 |
| Solubility | Insoluble in water. Dissolve peptide with 10% Acetonitrile with 0.1% TFA, then dilute up with water or desired buffer. |
| Storage Condition | Store peptide in DRY form at 0 - 5oC. |
| Appearance | White powder |
| Contact Information | peptide@pepmic.com |
| Website | www.pepmic.com |
2019年6月27日星期四
INSL 3 C-Peptide (Human) - Biotin Labeled
| Peptide Name | INSL 3 C-Peptide (Human) - Biotin Labeled |
| Sequence | Pro-Ala-Ala-Gly-Gly-Asp-Arg-Glu-Leu-Leu-Gln-Trp-Leu-Glu-Arg-Arg-His-Leu-Leu-His-Glu-Leu-Val-Ala-Asp-Ser-Asn-Leu-Thr-Leu-Gly-Pro-Gly-Leu-Gln-Pro-Leu-Pro-Gln-Thr-Ser-His-His-His-Arg-His-His-Arg |
| Species | Human |
| M.W | |
| Solubility | |
| Storage Condition | |
| Appearance | |
| Contact Information | peptide@pepmic.com |
| Website | www.pepmic.com |
INSL 3 / RLF (Human) - Biotin Labeled
| Peptide Name | INSL 3 / RLF (Human) - Biotin Labeled |
| Sequence | Biotinyl-(AAATNPARYCCLSGCTQQDLLTLCPY PTPEMREKLCGHHFVRALVRVCGGPRWSTEA) |
| Species | Human |
| M.W | 6517.7 |
| Solubility | Dissolve peptide with 10-20 µl of 60% Acetonitrile in water with 0.1% TFA or with 10-20 µl of DMSO, then dilute with any desired buffer. |
| Storage Condition | Store peptide in DRY form at 0-5oC. |
| Appearance | White powder |
| Contact Information | peptide@pepmic.com |
| Website | www.pepmic.com |
Inhibin Alpha-Subunit (1-32) (Porcine) - Biotin Labeled
| Peptide Name | Inhibin Alpha-Subunit (1-32) (Porcine) - Biotin Labeled |
| Sequence | Biotinyl-(Ser-Thr-Ala-Pro-Leu-Pro-Trp-Pro-Trp-Ser-Pro-Ala-Ala-Leu-Arg-Leu-Leu-Gln-Arg-Pro-Pro-Glu-Glu-Pro-Ala-Val-His-Ala-Asp-Cys-His-Arg) |
| Species | Porcine |
| M.W | 3597.85 |
| Solubility | Insoluble in water. Dissolve peptide in small amount of 60% Acetonitrile in water with 0.1% TFA, than dilute with any desired buffer. |
| Storage Condition | Store peptide in DRY form at 0-5oC. |
| Appearance | White powder |
| Contact Information | peptide@pepmic.com |
| Website | www.pepmic.com |
订阅:
评论 (Atom)