| Product | Copeptin (human) |
| Cat# | 55-4-01A |
| 3-letter-code | Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr |
| Sequence | ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY |
| Unit/Weight | 1.0 mg |
| Unit Price | $432.00 |
| MW | 4021.46 |
| CAS | 78362-34-2 |
| Formula | C177H279N49O58 |
| References | J.Struck et al., Peptides, 26, 2500 (2005) N.G.Morgenthaler et al., Clin. Chem., 52, 112 (2006) S.Q.Khan et al., Circulation, 115, 2103 (2007) G.Szinnai et al., J. Clin. Endocrinol. Metab., 92, 3973 (2007) M.Katan et al., Crit. Care, 12, 117 (2008) R.Seligman et al., Crit. Care, 12, R11 (2008) |
For custom peptides, please visit www.pepmic.com. Our peptide services including but not limited to:
*Peptide Synthesis: From short peptides to long peptides, linear peptides to cyclic peptides.
*Peptide Modifications: Peptide-protein conjugation, D-amino acid peptides, isotope peptides, fluorescent peptides, multiple antigen peptides, multiple disulfide bridge peptides, phosphopeptides etc.
*Catalog Peptides: ACE Inhibitors, Amyloids & Related Peptides, Antimicrobial Peptides, Apelin Peptides, Myelin Oligodendrocyte Glycoprotein (MOG) Peptides, TAT Proteins etc.
*Peptide Salt: TFA, Desalt, Acetate, HCl.
*Peptide Purity: From crude to ＞99.5%.
*Production Capacity: From mg to kg, with a capacity of synthesizing 15,000 peptides/month.
*Peptide Library Synthesis: Alanine Scan, Overlapping, Positional Scan, T-cell Truncated, Scrambled ect.
Quick Links:
Contact Information:
Eva He
eva@pepmic.com
Pepmic Co., Ltdeva@pepmic.com
www.pepmic.com
没有评论:
发表评论