[Tyr0] Calcitonin Gene Related Peptide, rat

Product	[Tyr0] Calcitonin Gene Related Peptide, rat
Cat#	55-3-36A
3-letter-code	Tyr-Ser-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asp-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Glu-Ala-Phe-NH2
Sequence	YSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2
Unit/Weight	1.0 mg
Unit Price	$375.00
MW	3969.5
Formula	C171H271N51O54S2
Disulfide Bridge	Cys3-Cys8

For custom peptides, please visit www.pepmic.com. Our peptide services including but not limited to:

*Peptide Synthesis: From short peptides to long peptides, linear peptides to cyclic peptides.

*Peptide Modifications: Peptide-protein conjugation, D-amino acid peptides, isotope peptides, fluorescent peptides, multiple antigen peptides, multiple disulfide bridge peptides, phosphopeptides etc.

*Catalog Peptides: ACE Inhibitors, Amyloids & Related Peptides, Antimicrobial Peptides, Apelin Peptides, Myelin Oligodendrocyte Glycoprotein (MOG) Peptides, TAT Proteins etc.

*Peptide Salt: TFA, Desalt, Acetate, HCl.

*Peptide Purity: From crude to ＞99.5%.

*Production Capacity: From mg to kg, with a capacity of synthesizing 15,000 peptides/month.

*Peptide Library Synthesis: Alanine Scan, Overlapping, Positional Scan, T-cell Truncated, Scrambled ect.

Quick Links:

Peptide Price
Peptide Modification
Peptide Library
Quote Request
Contact Us

Contact Information:

Eva He
eva@pepmic.com

Pepmic Co., Ltd
www.pepmic.com