Corticotropin Releasing Factor, bovine

Product	Corticotropin Releasing Factor, bovine
Cat#	34-3-11A
3-letter-code	Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
Sequence	SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2
Unit/Weight	0.5mg
Unit Price	$115.00
MW	4697.4
Formula	C206H340N60O63S1
References	F. Esch et al., BBRC, 122, 899 (1984)

For custom peptides, please visit www.pepmic.com. Our peptide services including but not limited to:

*Peptide Synthesis: From short peptides to long peptides, linear peptides to cyclic peptides.

*Peptide Modifications: Peptide-protein conjugation, D-amino acid peptides, isotope peptides, fluorescent peptides, multiple antigen peptides, multiple disulfide bridge peptides, phosphopeptides etc.

*Catalog Peptides: ACE Inhibitors, Amyloids & Related Peptides, Antimicrobial Peptides, Apelin Peptides, Myelin Oligodendrocyte Glycoprotein (MOG) Peptides, TAT Proteins etc.

*Peptide Salt: TFA, Desalt, Acetate, HCl.

*Peptide Purity: From crude to ＞99.5%.

*Production Capacity: From mg to kg, with a capacity of synthesizing 15,000 peptides/month.

*Peptide Library Synthesis: Alanine Scan, Overlapping, Positional Scan, T-cell Truncated, Scrambled ect.

Quick Links:

Peptide Price
Peptide Modification
Peptide Library
Quote Request
Contact Us

Contact Information:

Eva He
eva@pepmic.com

Pepmic Co., Ltd
www.pepmic.com