Fibronectin-Binding Protein

Product	Fibronectin-Binding Protein
Cat#	44-0-45A
3-letter-code	Phe-Asn-Lys-His-Thr-Glu-Ile-Ile-Glu-Glu-Asp-Thr-Asn-Lys-Asp-Lys-Pro-Ser-Tyr-Gln-Phe-Gly-Gly-His-Asn-Ser-Val-Asp-Phe-Glu-Glu-Asp-Thr-Leu-Pro-Lys-Val
Sequence	FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV
Unit/Weight	0.5mg
Unit Price	$85.00
MW	4309.7
CAS	119977-20-7
Formula	C190H283N49O66
References	C. Signas et al., PNAS, 86, 699 (1989)

For custom peptides, please visit www.pepmic.com. Our peptide services including but not limited to:

*Peptide Synthesis: From short peptides to long peptides, linear peptides to cyclic peptides.

*Peptide Modifications: Peptide-protein conjugation, D-amino acid peptides, isotope peptides, fluorescent peptides, multiple antigen peptides, multiple disulfide bridge peptides, phosphopeptides etc.

*Catalog Peptides: ACE Inhibitors, Amyloids & Related Peptides, Antimicrobial Peptides, Apelin Peptides, Myelin Oligodendrocyte Glycoprotein (MOG) Peptides, TAT Proteins etc.

*Peptide Salt: TFA, Desalt, Acetate, HCl.

*Peptide Purity: From crude to ＞99.5%.

*Production Capacity: From mg to kg, with a capacity of synthesizing 15,000 peptides/month.

*Peptide Library Synthesis: Alanine Scan, Overlapping, Positional Scan, T-cell Truncated, Scrambled ect.

Quick Links:

Peptide Price
Peptide Modification
Peptide Library
Quote Request
Contact Us

Contact Information:

Eva He
eva@pepmic.com

Pepmic Co., Ltd
www.pepmic.com